PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.114840.1
Common NameCsa_4G052740, LOC101213942
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family ARF
Protein Properties Length: 720aa    MW: 80134.9 Da    PI: 7.1687
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.114840.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B376.52.9e-24153253198
                     EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                     f+kvlt sd++++g +++ +k+a+e+       +  ++ +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD++vF   + +
  Cucsa.114840.1 153 FCKVLTASDTSTHGGFSVLRKHATEClppldmtQ--QTPTQELVAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDSFVFL--RGE 243
                     99****************************9643..445569************************************************..449 PP

                     EE..EEEEE- CS
              B3  89 efelvvkvfr 98 
                     ++el+v+v+r
  Cucsa.114840.1 244 NGELRVGVRR 253
                     999*****98 PP

2Auxin_resp108.95.5e-36279357182
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                     a+ha+st++ F v+Y+Pra  s+F+v+++k+++a+++k++vGmRfkm+fe+e+s+err+sGt+vgv d++p +WpnS+WrsL
  Cucsa.114840.1 279 ASHAVSTQTRFVVYYKPRA--SQFIVSLSKYMEAMNNKFMVGMRFKMRFEGEESPERRFSGTIVGVDDMSP-HWPNSEWRSL 357
                     789***************8..9*************************************************.*********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.22E-41138282IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.108.7E-42147268IPR015300DNA-binding pseudobarrel domain
CDDcd100175.14E-21151253No hitNo description
SMARTSM010192.5E-23153255IPR003340B3 DNA binding domain
PfamPF023622.7E-22153253IPR003340B3 DNA binding domain
PROSITE profilePS5086312.21153255IPR003340B3 DNA binding domain
PfamPF065074.3E-33279357IPR010525Auxin response factor
PfamPF023091.3E-6595644IPR033389AUX/IAA domain
SuperFamilySSF542775.49E-12602684No hitNo description
PROSITE profilePS5174524.182608689IPR000270PB1 domain
PfamPF023097.5E-6654691IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 720 aa     Download sequence    Send to blast
VEPILFLLCF LLLTCGGGGG GGGGEALIIM ANRGGGSLLP SSWCGDELYT ELWKVSAGPL  60
VEIPRINEKV LYFPQGHMEQ LEASTNQELN QKLPLFNLPP KILCQVVDTR LLAEQDSDEV  120
YAQITLMPEA NQALPSTFEP PLIECRKTKV HSFCKVLTAS DTSTHGGFSV LRKHATECLP  180
PLDMTQQTPT QELVAKDLHG YEWRFKHIFR GQPRRHLLTT GWSTFVTSKR LVAGDSFVFL  240
RGENGELRVG VRRLARQQSS MPSSVISSHS MHLGVLATAS HAVSTQTRFV VYYKPRASQF  300
IVSLSKYMEA MNNKFMVGMR FKMRFEGEES PERRFSGTIV GVDDMSPHWP NSEWRSLRVQ  360
WDELASIQRP DRVSPWEIEP FVAPTPSIPH SISVKNKRPR PPLEIPDSDN STVTTLRHPG  420
STSHDDRTQL SVSAAELKRF ENHATWHYKQ TDAGGNGNSV SRTAMEGSWL ASSSGCVSQH  480
RLQDLIDDRK SGSVWSTVFP GQLAAHSTCP TPRSSNTKSD QVQDLGEKGK KAEASPSCRL  540
FGIELINHSK SPVLTERAAD QPNSTPNEIT EAEQNSNLPK ISKERKLGLL QVPPKEIQHK  600
QNSSTSSRSR TKVQMQGMAV GRAVDLTTLE GYGQLIDELE KMFDIKGELR PRNKWEIVFT  660
DDEGDMMLMG DYPWQEFCNM VRRIYIWSSQ DVKMGSVSKL AMSALECEGT VITSESADS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-166303811355Auxin response factor 1
4ldw_A1e-166303811355Auxin response factor 1
4ldw_B1e-166303811355Auxin response factor 1
4ldx_A1e-166303811355Auxin response factor 1
4ldx_B1e-166303811355Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1396400KRPRP
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKU3234150.0KU323415.1 UNVERIFIED: Trichosanthes dioica clone TdARF_13 auxin response factor 9-like mRNA, partial sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011653224.10.0PREDICTED: auxin response factor 9
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A0A0KX410.0A0A0A0KX41_CUCSA; Auxin response factor
STRINGVIT_02s0025g01740.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15113396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.20.0auxin response factor 9
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]